Tesamorelin Peptide Specifications
| Property | Value |
| Name | Tesamorelin |
| CAS Number | 218949-48-5 |
| Peptide Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Molecular Formula | C221H366N72O67S |
| Molecular Weight | 5136 g/mol |
| PubChem CID | 16137828 |
| Synonyms | Tesamorelin, TH9507, MQG94M5EEO, 218949-48-5, DTXSID00583207 |
| Vial Size | Tesamorelin 2mg, Tesamorelin 5mg, Tesamorelin 10mg |
| Purity (HPLC) | ≥98.0% |
Tesamorelin Key Features
- Strict Research Designation: Engineered specifically to support in vitro laboratory evaluation and life science research applications.
- High Purity Lyophilized Format: Supplied as a freeze-dried powder to maintain biochemical integrity and minimize degradation pathways.
- Synthesized Analogue: Features an altered N-terminus structure intended to alter enzymatic stability as compared to native peptide sequences.
- Rigid Quality Standards: Products manufactured under stringent laboratory conditions to verify sequence identity and analytical purity.
- Standardized Laboratory Storage: Optimized to ensure long-term stability when kept under subzero thermal conditions.
- Reconstitution Flexibility: Compatible with standard laboratory diluents to enable custom assay concentrations.
Product Overview
Tesamorelin is a synthetic 44 amino acid peptide which acts as a stable analogue of growth hormone-releasing factor (GRF). Tesamorelin peptide has long been utilized in biochemistry and molecular biology studies as an agent that can pinpoint specific receptor affinity, kinetics and intracellular signaling cascades. This compound stands out from others by virtue of its N-terminal modification; specifically, by attaching a trans-3-hexenoic acid group at its N-terminus. Chemical modifications of synthetic peptide research have long been the focus of synthetic peptide studies, as they prevent immediate proteolytic cleavage by enzymes such as dipeptidyl peptidase-4 (DPP-4). Thus extending its experimental half-life compared with native sequence.
Tesamorelin emerged out of efforts within the life science industry to synthesize stable secretagogue analogues capable of maintaining structural integrity during extended laboratory investigations. By altering terminal amino acid configuration, researchers were successful in creating a molecule with sustained binding affinity to specific GPCRs (growth hormone-releasing hormone receptor) like GHRHR.
Tesamorelin has become an indispensable component of laboratory research across the United States, Canada and Australia in recent years, offering researchers an easy means of studying neuroendocrine signaling pathways. Because its structure allows for controlled exposure within cell cultures, Tesamorelin provides reliable control mechanisms for measuring secondary messenger activation such as cyclic Adenosine Monophosphate (cAMP) accumulation or downstream transcription factor modulation. Understanding its basic chemical and structural properties enables life sciences researchers to design highly controlled in vitro protocols without confounding variables associated with rapidly degrading native peptides or rapidly degrading native peptides that would otherwise confound results.
What Is Tesamorelin?
From a chemical viewpoint, Tesamorelin can be classified as an N-terminally modified peptide analogue. Its primary sequence derives from that found naturally within 44 amino acid peptide responsible for stimulating specific endocrine axes; however, its chemical resilience has been optimized through organic synthesis to reduce rapid degradation due to enzyme degradation; an incorporation of trans-3-hexenoic acid moiety at Tyr1 prevents rapid degradation by enzymes–an additional feature not found within native peptides.
Tesamorelin marks a key educational milestone in peptide design. Unmodified peptides typically exhibit transient profiles in experimental settings, making accurate data collection about receptor dynamics challenging. By adding specific structural modifications, synthetic peptide research has made strides toward providing tools that remain stable during extended observational windows in cell assays; laboratory models allow for the quantification of receptor-ligand interactions, binding kinetics, and structural biology profiles with ease.
Tesamorelin Peptide in Scientific Research
Laboratory investigations often use Tesamorelin peptide to explore cellular signaling pathways. Researchers utilize its synthetic analogue in order to track down every step triggered upon receptor activation. Because this compound has high-affinity for specific receptor sites on cell membranes, researchers are able to observe cell responses under controlled circumstances.
Experimental studies with Tesamorelin typically focus on:
- Receptor Binding Affinities: Evaluating precise dissociation constants (Kd) and association rates between modified peptide sequences and their native sequence counterparts.
- Intracellular Messenger Tracking: Tracing activation of Adenylate Cyclase and subsequent rise in intracellular cAMP levels after exposure to peptide.
- Enzymatic Resistance Profiles: By subjecting the compound in question to various proteolytic enzymes in vitro, one can gain insight into potential degradation pathways and structural vulnerabilities.
Research methodologies using Tesamorelin require laboratory staff to account for variables like vehicle composition, ambient temperature and pH level of culture medium as these influences significantly impact its conformational stability and interaction rates during assays.
Scientific Background
To understand Tesamorelin in modern biochemistry, one must explore its place within peptide biology and receptor research. Peptides serve as crucial signaling molecules within biological systems, binding to specific cell surface receptors to induce intracellular responses and understanding cellular communication and metabolic regulation at a molecular level.
[Tesamorelin Peptide] —> [GHRH Receptor Binding] —> [Adenylate Cyclase Activation] —> [Increased Intracellular cAMP]
Tesamorelin research centers around a specific receptor target from the G-protein coupled receptor superfamily. When exposed to ligand binding, these receptors undergo conformational changes that activate internal heterotrimeric G-proteins that modulate downstream effector enzymes. Researchers use Tesamorelin in scientific literature to explore how structural modifications to ligands affect receptor-mediated signals and their duration and intensity. Current academic inquiries continue to investigate how peptides behave across diverse cell lines, providing invaluable data for global life science researchers regarding stability, synthesis methodologies and molecular pharmacology.
Storage and Handling Guidelines
Proper storage and handling is key to protecting Research Use Tesamorelin. Although lyophilized peptides tend to be more stable than their liquid counterparts, they still may become compromised under unfavorable environmental conditions.
- Temperature Considerations: To preserve long-term stability, lyophilized peptide vials should be stored immediately at temperatures between -20℃ and -80℃ for long-term storage. In order to limit residual chemical activity.
- Moisture Protection: Moisture is one of the primary catalysts of peptide degradation via hydrolysis, so vials must remain hermetically sealed in order to avoid atmospheric moisture forming condensation on their cold powder contents and leading to degradation. Before opening and reconstituting vials at room temperature, allow it to return to equilibrium by slowly warming it. This ensures no condensation forms on cold powder during reconstitution.
- Light Protection: Direct ultraviolet (UV) light may induce photooxidation and alter amino acid side chains. For maximum effectiveness, vials should be stored in dark environments or opaque containers to protect from direct UV light exposure.
- Laboratory Handling Practices: When dissolving peptides in solution, any physical agitation or vigorous shaking should be avoided to protect its tertiary structure and avoid mechanical shear forces which could potentially disrupt it. Gentle swirling is recommended during preparation.
Frequently Asked Questions
What Is Tesamorelin?
Tesamorelin is a 44-amino acid synthetic analogue of growth hormone-releasing factor produced endogenously in our bodies, featuring an N-terminus with enhanced stability against enzymatic breakdown, making it a useful tool in laboratory studies of receptor signaling pathways.
How should Tesamorelin be stored?
Lyophilized Tesamorelin should be stored at temperatures between -20℃ and -80℃ in order to maximize long-term stability, while once reconstitution occurs it should be refrigerated between 2-8℃ before being utilized within a short window to avoid degradation.
What does Lyophilized Peptine mean?
Lyophilization is a freeze-drying process in which water is removed from frozen products after they have been frozen to produce a stable crystalline powder form that extends shelf life, maintains structural integrity, and ensures safe transport.
Is Tesamorelin intended for research use?
therefore it must only be used in in vitro laboratory evaluation and life science research applications. It must not be consumed by humans, used as diagnostic procedures or therapeutic intervention strategies.
What Is Peptide Reconstitution (PRR)?
Peptide reconstitution refers to the process of adding liquid solvent or diluents such as sterile bacteriostatic water or laboratory-grade saline to a lyophilized powder to bring it back into liquid solution form suitable for experimental assays.
How is Tesamorelin classified in Peptide Research?
Tesamorelin falls under the category of stabilized secretagogue analogue. Due to its unique properties, this synthetic peptide can be found among synthetic peptides designed for studying G-protein coupled receptor interactions and downstream signaling mechanisms.
Why Does Tesamorelin Have an Altered N-Terminus?
Adding trans-3-hexenoic acid groups at its N-terminus helps protect it from being rapidly broken down by dipeptidyl peptidase-4 (DPP-4), giving researchers more time to study its effects than with native peptides.
Research Notes
Important Laboratory Notice: Tesamorelin Peptide is supplied exclusively for scientific exploration and laboratory use. All materials provided on this page are for educational and informational purposes within the fields of life science research and synthetic peptide chemistry. The biochemical properties detailed herein refer solely to documented academic literature and in vitro observations. This product must be handled by qualified laboratory professionals utilizing appropriate personal protective equipment in accordance with local safety regulations.
Scientific References
- Peer-Reviewed Journals: Consult the Journal of Peptide Science, Biochemical Pharmacology, and the International Journal of Peptide Research and Therapeutics for peer-reviewed studies regarding N-terminally modified peptide kinetics.
- Research Institutions: Refer to published whitepapers and structural biology reports available through major life science research universities globally.
- Scientific Databases: Review chemical profiles, binding assays, and structural data via open-access repositories such as PubChem (CID 16137828), UniProt, and the Protein Data Bank (PDB).
Get a Quick Quote
⚠ Intended Use
All products are intended for in vitro laboratory research use only.
They are strictly prohibited for administration to humans or animals, and must not be used for diagnostic, therapeutic, or clinical applications.
Storage and Handling
Store lyophilized powder at –20°C.
After reconstitution (for laboratory analysis), store at 2–8°C.
Avoid repeated freeze-thaw cycles.
Maintain aseptic technique during handling.







